Best subclass for shadowheart. New comments cannot be posted and votes cannot be cast.
Best subclass for shadowheart Hey everyone! I’m not really enjoying Shadowheart’s Trickery domain. Its healing bonus So My favorite shadowheart is where I respec her to an oath of ancients asap then I immediately break her oath Circle of the Land would be the most fitting subclass, and you're probably still looking at a support-oriented build that uses many of the same spells. Being good at burglary is kind of a staple of vampires, and the extra bonus action is perfect for Astarion as it feels like cheating. These are best companion respec options in Baldur's Gate 3 (BG3) to keep them true to character without forgoing their naturally powerful builds. Shadowheart is a perfect example as she is perfect to give buffs to your party. Maybe in a more stealth oriented party or I should try For the best Shadowheart build, ensure you have the Light Domain subclass. Thaumaturgy is good as a choice for your cantrip as it can be used to help with dialogue checks, and Guidance is pretty universally useful as well. While the Life Domain is your bread and butter for healing and protecting others, the War and Tempest Domains bring Shadowheart’s combat and tanking abilities to the surface, allowing you to use Recommended Subclass. If you take away the alignment good/evil and look at the funktion only (knowledge to do things, also evil things), I could justify also Light for Shadowheart, it's for blasting things away for the evil cause. If Best subclass for Shadowheart in BG3. If Shadowheart has that covered, you could start with one level of Sorc and get a subclass feature like Draconics free spell and built in Mage Armor or Tempests Flight, then you'll have good damage cantrips, the Shield spell and Mage Armor or Magic Missile, and Constitution saving throw proficiency. I want to switch out one of the party members for Shadowheart and want to keep her as mainly a cleric for the Gauntlet through the end of Act 2 for more healing. Fighter also works well since dexterity. give your answers below Shadowheart - Paladin of Ancients, Half Wood Elf Gale - Eldritch Knight, Human Karlach - Bard of Valor, Tiefling It looks like I'll see act 2 and I want to use Shadowheart in my main Act 2 group because of her storyline progression. Whatever subclass you choose for Shadowheart, these synergize perfectly with her innate healing spells like Cure Wounds or Healing World. Controversial Paladin is top tier class, you get alot of heals, smite for damage, aura that gives your party your charisma modifier to all saving throws(so like +5 to all saving throws at 20 charisma), very strong, but cleric is just as strong. Due to the Cleric’s usefulness, many players are asking what is the best Shadowheart build in Baldur’s Gate 3?. geala OP. What is the best add class for Shadowheart? Shadowheart has the potential to be the Chosen of either Shar or Selune, but each goddess has very specific requirements for how that comes about. Old. The essence of this guide delves into the heart of Shadowheart's potential—not as a Trickery Cleric, but reborn under the auspices of the Life Domain. Imho even though it's not my favorite subclass, you can make Shadowheart a Knowledge Cleric and not have to change domains. All are good at different things. I’m curious about Gale Best Builds for Shadowheart Best Subclasses for Shadowheart Life Domain for a Better Healer and Support Role. My idea is going for 3 levels of rogue chosing thief subclass, 5 levels of gloomstalker and 4 levels of trickery domain cleric for invoke duplicity, mirror image and additional feat. And roleplaying as either Shadowheart's romance is a bit too romantic early on vs. Ancients is the best defensively. Classes & Builds. 14 Dex is right for the most AC out of medium armour. Enhance Ability is good, as it gives you advantage on skill checks related to a particular ability. Sub class For, Tempest Domain gives us the Heavy Armor proficiency, so we can get closer to melee to fire off our Spirit Guardians and other close-range spells. In order to make Shadowheart an effective healer, we advise you to respec her as quickly as possible, and to choose the Domain of Life . Battle Master on Lae'zel will allow her to be a more flexible or damage-oriented fighter. Compendium - Sources->Dungeons & Dragons->Guildmasters' Guide to Ravnica. The best subclass for Wyll is Fiend because it provides high damage at range along with extra temporary hit points upon killing an enemy. I would say strongest, because after playing trickery and life clerics I would like her to be a little stronger. Draconic Bloodline is our pick for subclass because you get Draconic Resilience, Draconic Ancestor, and Draconic armour class, which have high survivability and allow you to focus on a particular elemental magic type. Open comment sort options especially in the early days of this game's modding lifespan. Character Build I chose draconic bloodline sorcerer with the white dragon ancestry because it’s the exact same as one of my all-time favorite player characters in regular D&D. We will be adding links to good beginning mods, information on creating your own mods, and tutorials on how to mod very quickly Shadowheart best subclass. And it gets Heavy Armor proficiency, just like Life Clerics (and War, of course) would, so AC isn't a problem, and if they do close in, Wrath of the Storm is a Best Shadowheart build in Baldur’s Gate 3 stat and subclass breakdown. Mentioning healing separately when describing a subclass implies that the subclass is somehow good at it. Reply reply My self-made Shadowheart cosplay 2. 1. The best subclass (domain) for Shadowheart When you recruit Shadowheart as a companion or select her as an origin character, the latter is a Cleric of the Domain of Cunning. Plus it provides some hard hitting spells. Any advice would be great and i do want Shadowheart - Trickery Domain (not sure if we can change it) - Shadowheart disapproves Wyll - The Fiend If you read it as that she isn't fully in control once she rages, the chaotic wild magic should be a good fit /laugh Plus I find the subclass compelling Lae'zel - I can see myself going either way with Battlemaster/EK, will see what my Best build that I think for Shadowheart is Radiant damage build. Two levels in monk gets you step of the wind: dash to repeatedly jump all over the place and hit the whole map with Yes and no. This choice transforms her into an unparalleled support character, ensuring your party remains healthy and ready for any challenges that may arise. that looks kinda painful shadowheart 2. The Battle Master subclass is the best subclass for the Best Baldur’s Gate 3: Lae’zel Companion Build because it is the most versatile and adaptable. I’d love to hear your thoughts on what the best subclass for her might be! Shadowheart Tempest: Best Subclass and Features Baldur's gate 3 shadowheart. Here’s the list of the Fighter’s Subclasses: Battle Master: is a more versatile subclass for the Fighter. Naturally, let's not forget also that Shadowheart is a romanceable character in Baldur’s Gate 3. That said, you can change them fully by having Withers change their classes to whatever. She’s been situational useful, I have guiding bolt which melts shadow enemies,and healing word is good at picking up downed party Returning 6 results for 'beasts subclass for shadowheart'. Best thing is the requirements of Shadow Step and the spear's extra damage are the same so guaranteed advantage and damage as well. Act 3 spoilers You cannot kill Nightsong, you will oathbreak. According to the wiki 4 of the other subclasses even grant heavy armor proficiency. Best Bard Class Build. Best BG3 Shadowheart Build. HOWEVER knowing that we can now reach lvl 6 Sorc for the second subclass feature, I'm not sure I'd stay a Storm Sorcerer. I haven't respec'd her. The Best Subclass for Shadowheart build is Life Clerics because it provides the best overall healing and group utility for a support class. So does everyone think our companions have a “canon” subclass? Even if you disagree on that, which one do y’all think fits them “the best”? I will give my thoughts. Only thing missing is a skill focused character for things like lockpicking. And the spells you get to start with are pretty situational. 5. Shadowheart as a companion can dip into the anti gith racism a bit too hard. Best BG3 Shadowheart Build; Best BG3 Astarion Build Guide; Best BG3 Gale Build Guide; BG3 Classes and Subclass List; BG3 Tier Lists & Top Series; Throne and Liberty. If you don't have a rogue, Way of Shadow will let you break the game in half with stealth. What is the Best Class for Shadowheart in Baldur’s Gate 3? The Best Class for Shadowheart in Baldur’s Gate 3 is Tempest Cleric! A flexible Cleric subclass that offers access to a few devastating spells. I loved playing with Shadowheart as a pure shadow monk. This subclass makes it one of the best builds for Sorcerers. The top three best Shadowheart builds are the Life Domain, War Domain, and Tempest Domain Cleric builds. OP. But I feel Death Domain would push her to a level of evil that doesn’t currently suit her personality. The best subclass for Shadowheart (or Shart, if you're so inclined) is easily the Life Domain. Open comment sort options. As a support class, Shadowheart is incredibly versatile and can fit into various party compositions. There is some slight immersion break with Smite, but Shadowheart comes loaded with Sacred Flame and Guiding Bolt so I wouldn’t be too stressed about it. Light domain gives you one of the best defensive reactions in the game. I, wanting a cleric, decided not to reclass Shadowheart. Fear is great tho. Changing Shadowheart's Subclass Shadowheart : A very hard sell (narratively) not to make her a Trickery Cleric. Karlach, Gale and Shadowheart default classes already cover a balanced team comp. As for thinking it is either war or tempest I feel, also unsure if to do a strength or dex build with her. The cleric subclass could also be changed in favor of one granting heavy armor should i want to use equipment that requires it (giving up warding flare and fireball tho) full spell slot progression for upcasting spirit guardians There are a variety of roles and builds that she can take as a member of your party, even as a defender if her subclass changes. RELATED: It’s a very good idea. Shadowheart (Frontliner) TL;DR: Sorcerer (Storm) 1 / Cleric (Light) 11 This build dips into Sorcerer for Constitution saving throws, bonus action flight upon casting a spell for mobility, and the Shield spell. Blessing of the trickster is nice but I'm not doing much stealth for my first playthrough. Clerics are limited to light or medium armor in Baldur's Gate 3 Because the best choice for both path is to romance her as Laezel. not good. Cleric Subclass. The Thief subclass can be unlocked at level 3 and is great in combat and outside to provide your team with high damage and great group utility. They are saying "it's this subclass because X. Therefore, this subclass plays best as a hybrid weapon and spell-casting damage dealer with some support. At first my weakest character in the party was sorcerer, mainly because he requires long rest in order to recover his main abilities, but after I obtained haste he became a really good support for Laezel (fighter) and Karlach (barbarian), so at the moment Shadowheart is the For a specialized Shadowheart build, consider the War Domain subclass. For this Shadowheart build, you still choose the Cleric class and Life Domain subclass. By default they’re fine, except Shadowheart. For my shadowheart I'm pushing cleric life 1/ bard lore 11 and it became an awesome support (it's time her harsh comments start hurting someone else's feeling too), with the mod I think I would complete bard 12 and fill cleric. Moreover, the Fiend subclass allows for aggressive spell caster without being as punishing as other builds. I find the Trickery Domain rather underwhelming, but I’d like to try to keep things as lore-accurate as possible. Any ideas on what the current best Cleric build is? I currently have her as a light Cleric. That’s on top of having some of the best buffs and healing word along with some super useful channel divinities and some decent spell lists. I respecced her Light and never looked back. She will always be a Battlemaster in my heart. Outfit her with these armor pieces in Baldur's Gate 3 to make the most of her potential. Joined: Jul 2017. Best Cleric Class Build. Related Baldur's Gate 3: Best The Best Subclass for Shadowheart build is Life Clerics because it provides the best overall healing and group utility for a support class. Later Life Domain is the best subclass for Cleric in Baldur's Gate 3 if you wish to go the healer route with our handy build. You will not have Light Cleric is probably the best tank in game. The only exception would be the Death domain which is the only other Sharian Domain available to clerics of the Nightsinger. Controversial. I don't mean canon. This is a good just brought shadowheart into my party because people said she was good so now i have to pick a feat (party is: Tav, Lae’zel and Astarion) Archived post. Best. The Subreddit for New World, an Open World MMO created by Amazon Games Collections My Characters My Campaigns My Encounters My Dice Baldur's Gate 3- Shadowheart Subclass Multiclassing Guide to level 12Become a Patron of the Channel!- https://www. The best subclass for Shadowheart is undoubtedly the Life Domain rather than her original Trickery Domain. It gives her versatility as a unit that can provide . All Throne and Liberty Builds; Greatsword Builds; Dagger Builds; Sword & Shield Builds; Longbow Builds; Crossbow Builds; Best BG3 Shadowheart Build; Best BG3 Astarion Build Guide; Best BG3 Gale Build Guide; Best BG3 Lae’zel Build Guide; Best BG3 Wyll Build Guide; BG3 Classes and Subclass List; BG3 Tier Lists & Top Series; Throne and Liberty. trueor a Tempest Cleric, if you're focused on (ranged) casting. This will help you make this build a great healer. Additionally, it is important to allocate her Proficiencies What subclass would you go for evil shadowheart? Trickery feels like ass Reply reply ruskyandrei • Of the ones we have trickery is definitely the best RP fit for evil Shadowheart, being a Shar worshipper and all. The War Domain subclass Also if you have some advice for specificity on my party (eg : subclass for cleric) im all open for it! Archived post. 10 should be enough. Subclass wise there isn't any great choices. Learn how to optimize Shadowheart, a High Half-Elf Cleric, as a support class with Life Domain subclass. More will details be explained in the Level Progression, but consider this a unique Cleric build with an elemental twist and big damage with weapon Best Subclass and Ability Scores for each party member? Character Build For example, I changed Shadowheart into a Life Cleric, and moved some of her ability points into STR so she can function as a beat stick when she's out of spells. For Shadowheart I respec her to light domain after her quest Best subclass for Shadowheart in Baldur’s Gate 3. You'll have good support with bless. Dps Sorcerer best subclass Best Shadowheart subclass. For this Best Baldur’s Gate 3 Trickery Domain Cleric Build, we will use the Trickery Domain subclass which is the default build for Shadowheart companion. By default, Shadowheart is a Trickery Domain Cleric in BG3. This is how I'm planning to build the rest of my team TAV - My Tav is a Half-Orc Paladin that I plan to multi into a Crowd Control Sorcerer at character level 6 (Storm subclass), with a split of 5 / 7 in favour of Sorc. Unless you plan on playing as a Druid or Cleric or even use Shadowheart as your character. Lae'zel's supposed to be a gifted warrior. com/myusualmeDon't forget to Subscr My favorite for Shadowheart was twilight cleric, which actually comboed really well with Karlach's fire build because of the defensive synergy of twilight sanctuary and the spell (from 5e spells) that allows creatures in 30ft 0 damage on successful saves against magic. ). You need to have found Withers Shadowheart operates best as a high AC support bot with light orb gloves using spirit guardians to spread damage and light orbs all over the battlefield. She is my tank and does pretty good damage with multiple melee attacks Gale - Wizard. Monk 7 gives stilness of mind which is useful for removing frighten, vs cleric 6 which gives some better subclass features and a second channel divinity charge. And that's where Shadowheart picks up the slack. Trickery is a good subclass though. It’s up to you whether you keep her original subclass or opt for a change, but the best subclass for Shadowheart is undoubtedly the Life Seems Light is a popular pick, might have to check it out then. I personally also did not like Trickery. As an aside: Do not "top people off" in combat with Shadowheart's healing spells. This is a subclass focused on dealing Necrotic damage, and comes with unique Necromancy spells. Best Druid Build. Druid, Ranger and Monk work the best since they all use their wisdom and dex (druid perfers it). More posts you may like Related Baldur's Gate Role-playing video game Gaming forward back. So my question is twofold: (1) What class/subclass do you think fits Durge the best storywise? (2) What class/subclass did you find to be the most powerful build for your Durge? Like, I love making Shadowheart a War Caster Cleric and Astarion an Assassin Rogue, but storywise it's not very accurate. Vengeance has the best damage and offensive power, with ways to get advantage on attacks and misty step for mobility. By Ali Asif 2023-11-14 2024-05-04 Share Share Cleric - Subclass selection at level 1 helps a lot (some offer extra attack, reactions, etc. As for subclasses, IMO you should just pick the best subclasses for the various classes. Shadowheart defaults to Trickery, which is similar to this build and can be modified. For the six origin characters that would be: Shadowheart—Light domain, requires a respec Astarion—Thief Lae’zel—Battlemaster Gale—Evocation Wyll—Infernal/Blade Karlach—Berserker Returning 8 results for 'blade subclass for shadowheart'. Battle New Subclass for Shadowheart? #873534 01/08/23 04:26 PM. If Shadowheart needs more support, equip her with heavier armor and choose spells that enhance her build. "Trickster" cleric seems unnecessary. The subclass doesn't really matter. The other subclasses are pretty good too. This build has been updated for the Patch 7 version of Baldur’s Gate 3. Tempest Domain for the highest potential damage you can probably get out of a Cleric. Very good on a Life Divination is for sure the best subclass. I’m lvl 7 on tactician just at start of act 2. And I did. r/BaldursGate3. Enderal is a total conversion for TES V: Skyrim: a game modification set in its own world with its own landscape, game mechanics, and story. The loss of spells isn't too bad because the polar opposite for Shadowheart for good runs is 11 Cleric 1 Monk going Light and becoming a Light Cleric (life just doesn't interest me enough) or staying in Shadows. In the world of Baldur’s Gate III, Shadowheart is a complex and intriguing character, with a rich backstory and a multifaceted personality. More posts you may like As I’ve waxed poetic about several times in previous Shadowheart builds, I have a strong allegiance to the chosen deity’s domains when picking a subclass, and have only ever been able to justify Light Domain outside of that guideline because it’s so good in game and feels right for Shadowheart’s character growth. patreon. Light provides warding flare which is a very good defensive reaction, and For Shadowheart, I can take whatever Domain but War is still my favorite. This build is a full support role, and it focuses on healing your party. If enemies attack us, the Wrath of the Storm ability allows us to retaliate as a Reaction. The best feat is generally to just give them ASI +2 boost into whatever STAT is most relevant to their class. Character Build Is War cleric good or is light cleric better? Share Sort by: Best. Yeah Trickery suits Shadowheart perfectly. My Main character is a Vengence Paladin who is a Tank and does a bunch of damage. I just can't picture her as any other domain, and honestly I wouldn't even be surprised if she was subclass-locked, considering the choice is made at level 1 and how utterly nonsensical she'd Shadowheart - 12 Trickery Cleric The Blessing of the Trickster is relatively useful if she goes at the same time as a couple of other characters, as it will allow all of them to get Advantage shortly before the illusion gets nuked, since Ok so contemplating over a half orc build focused on crits (because of the 3x bonus to attacks on crits instead of 2x) I know the Champion subclass for fighters has increased chances to crit, I’m wondering if there are other classes which are better for crits (in your opinion) or if I should just go with the champion. My early game setup for Shadowheart usually is a tempest cleric with heavy armor that wields Phalar Aluve and buffs my team and casts create water to Best Shadowheart Magic Items in BG3 The Whispering Promise, Hellrider’s Pride, and Wapira’s Crown. Best Permanent Bonuses for College of Glamour Bard in Baldur’s Gate 3 College of Glamour Bard Changes in Patch 8 for BG3 Baldur’s Gate Patch 8 (Image via Larian Studios) BG3 released 12 new subclass in patch 8 So is the best route to get Shadowheart best ending- Act 3 - Spoilers One version of Shadowheart makes the right choice when presented with a chance to have her parents back. Trickery, isn't considered good in Baldur's Gate 3 and is probably the least effective Cleric subclass. The Life Subclass comes with Heavy Armour Proficiency, Disciple of Life, and Domain Spells. Compendium - Sources->Dungeons & Dragons->Player’s Handbook. Generally, in the scope of bounded accuracy (or at Shadowheart is one of the most popular Companion characters in Baldur's Gate 3, and that's not only because she has one of the best storylines. (BTW I've been spoiled on everything with What is a good subclass/multi-class build to keep Shadowheart as a more "back line" character? I have Karlach and my Tav up in melee and a third character would make it a little too busy on the front line. Tempest is probably my favorite subclass for Cleric. Useful For Shadowheart's Default Subclass . Rogue 4 gives you access to sneak attacks and lets you be an Assassin (which guarantees sneak attacks on turn 1) and Fighter gives you access to a powerful Fighter subclass along with action surge for 2 more shots on a Gale always made more sense to me as Evocation and I always make Astarion an Assassin, though I do think Thief fits equally well. That subclass freaking shreds, with Wet enemies, Call Lightning or Channel Divinity on a Chain Lightning scroll for max damage. com. Other than that she doesn't do much in combat. Best Feats for Shadowheart: You should free and recruit Shadowheart and keep her in your party, as she is the only main healer in the game. Shadowheart at Level 2 Larian Studios Shadowheart ; Astarion; Best subclass. Reply reply More replies More replies. I recommend changing the subclass to Life Domain for the best Shadowheart build in BG3. The lore-friendliness I can sort of ignore, to a degree. The best subclass for our Baldur’s Gate 3: Best Gale Companion Build is Evocation because it delivers the most area-based damage in the game making it a perfect fit for a Wizard build. I just got to the point where i can respec and want to do so with Shadowheart, so long as I leave her as a cleric will it affect her reactivity any if I change her domain. I will obviously exclude Wyll and Shadowheart because not only do they get their subclass off rip, but they also match them perfectly. I'm coming to the end of Act 2 and she's currently in the Dark Justiciar gear - the AC is 1 below what she had before (Yuanti, as I gave her the dex gloves) but I think the advantage on concentration roles might be worth it. Advertisement . Selesnya and Golgari rangers are focused on protecting their communities. As a Life Cleric she went from the weakest link to The Best Subclass for Shadowheart build is Life Clerics because it provides the best overall healing and group utility for a support class. Karlach and Gale put out raw DPS, Astorian’s assassin subclass means he gets big damage to start fights and any time he gets a sneak attack it’s good damage, but Shadowheart has been very lacking all game. This alteration will improve her healing abilities and make her a valuable member of your team. The Cleric is one of the most versatile classes, so Companion subclass choices are adaptable: Baldur’s Gate 3 lets you customize your companions’ subclasses, so feel free to experiment and find what works best for your playstyle. The difference really is night and day. Could even do Illusion Wizard for RP. Shadowheart starts the game as a Trickery Domain Cleric which is 52 votes, 24 comments. Currently, she’s at level 8 and almost at level 9. Some players prefer Light or Tempest domain for Shadowheart. Party is currently level 8. At that point I respecced her as Life. the enemies to lovers / angry hatesex vibes you can read into a player Shadowheart doing the Lae'zel romance. The Light subclass gives us Warding Flare for But I gotta say, regarding Shadowheart, it really looks like the trickery subclass sucks compared to the others. Also useful for getting armour proficiency w/o sacrificing caster progression. Til Death Do Us Part is a good ring that offers Shadowheart the ability to cast a free Beacon of Hope spell once per Long Rest. What is the best weapon for Shadowheart? While the game presents several good options, the Devotee’s Mace is a strong contender, especially for a Life Cleric build. I didn't realize that her cleric subclass is . Trickery suits Shar very well, even though it's not the best subclass I think I'm pretty settled on a party comp but I can't quite decide which subclass to respecc Shadowheart into. BG3 Classes and Subclass List; BG3 Tier Lists & Top Series; Throne and Liberty. Is there a better way to build SH, and what are some good builds for the rest of the gang? In this current playthrough, I'm making Shadowheart multiclass into Paladin. Best subclass for Paladin . Find out how to recruit, respec, and level up Shadowheart in this comprehensive guide. You can use any cleric subclass that has Guardian Spirits spell, although i prefer Tempest. Subclass . 12 votes, 14 comments. Life’s domain spells also feature most healing and restorative spells, freeing learned It is so fun to find good combinations that work and wield crazy results. Karlach: Which is the best subclass for her? Character Build I just got Karlach on my team, and as I am level 3, she gets to pick her subclass now. Baldur's Gate 3 Light Domain Cleric Build for Shadowheart - best skills, abilities, gear & spells. Equipment: Holy Lance Helm Luminous Armour Luminous Gloves or Gloves of Belligerent Skies Boots of Stormy Clamour Coruscation Ring Callous Glow Ring Baldur’s Gate 3: Best Light domain Shadowheart build There are quite a few different subclasses for Clerics, but I find that the Light Domain produces very powerful spellcasters . Q&A. Share Sort by: Best. Tempest Sorceror fits thematically and Shadowheart Tempest: Best Subclass and Feats. Paladin/Cleric is a gem, and Shadowheart is a big lover of animals, even before The Event, and if you make her a Paladin it says "Paladin of Shar", which. Dump INT and use the Warped Circlet of Intellect and later the Circlet of Intellect to set INT to 17 and 19 respectively is how you build a functional Wizard / cleric. . Shadowheart is one of the most popular Companion characters in Baldur's Gate 3, and that's not only because she has one of the best storylines. That being said, don't over think the labels; you serve the Lord on the Rack with your deeds, not your subclass! Edited to add: Look at them this way. r/newworldgame. Astarion- Assassin. Compendium - Sources->Dungeons & Dragons->Free Rules. The newest cleric subclass is the Death Domain. Best Companions for Cold Build. While Shadowheart begins as a Trickery Domain Cleric, we’ll change that to Light Domain to make this build work and make her a better It’s up to you whether you keep her original subclass or opt for a change, but the best subclass for Shadowheart is undoubtedly the Life Domain rather than her original Trickery Domain. So with three levels already wasted on trickery domain, how should I reclass Shadowheart? I'm playing co-op, so my party already has a Lore Bard and Wizard for all battles. The most recommended respec is at least just switching Shadowheart to a different cleric domain — Life or Light cleric are most popular for her. Lae'zel - Fighter. One that can overpower any foe despite being a frail wrinkly space frog. Subclass selection will be unlocked at level 3 for the Fighter Class. You don’t need 14 Str. Classes and Builds. Top. I spent hours trying to find a good mix. Character Build They have said that we can respec the Origin characters, but that it could mess with their stories or make it nonsensical. She is a very useful character and has one of the best backstories in the game, making her the second act’s protagonist. There are other ways to get a permanent fly without needing to do spellcasting. BG3 is the third main game in the Baldur's Gate series. I like light clerics radiant / fire spells and the reactions. Adding powerful characters to your party is a great goal in Baldur’s Gate 3. Start with cleric, then take cleric to level 2 for subclass feature, then take cleric to level 5 for spirit guardians, then take cleric to level 6 for improved subclass feature, then take cleric to level 7 for 4th level spells, then take cleric to level 9 for another subclass feature and 5th level spells, then finally take 3 more levels in cleric for Divine Intervention, 6th level spells, and Shadowheart (Cleric x Paladin x) Wyll, Gale, and Lazel have no place in my party for the most part - i fully expect larian to nyx extra party members at some point; if they dont i dont plan on using them for the most part. Draconic Bloodline is the best subclass for the Sorcerer because you gain access to Draconic Resilience, Draconic armour class, and Draconic Ancestor. This is the best subclass of Cleric because it balances out all the damage and healing powers of the character. Sanctuary Shadowheart: Paladin could work, but honestly Cleric is the best option given her story and 'lore. To maximize Shadowheart’s effectiveness as a healer, we strongly recommend selecting the Life Domain subclass for her character in BG3. Other Suggestions: blessed subclass for shadowheart blast subclass for shadowheart best subclass for shadowheart. I use her for healing and spirit guardians/spirutual weapon. The Cleric is one of the most versatile classes, so Shadowheart is much more than a designated healer. Lae’zel would be classic enemies-to-lovers, and fellow cult-absconders. Life cleric is good if you want a tanky heal god. Your question was "what is objectively the best monk subclass" and the objective answer to that is "it depends on your party makeup", in which Gale is an option. The Berser ker Barbarian is the best subclass for Karlach in BG3 because she’s a melee damage dealer with a free smite spell as a Tiefling, and Soul coins give her a passive 1d4 fire damage when raging. What armor should Shadowheart wear? Best cleric subclass for Shadowheart . She is one of the best companions and is the only healer out of all the companions you will find in the game, making her invaluable on the battlefield. So it's a decent bet if you want a version of Shadowheart than can still It's really not. Reply reply Loud_Consequence537 • • My self-made Shadowheart cosplay 2. Despite initially being designated as the Trickery Domain Subclass for a Cleric, it would be beneficial to switch Shadowheart’s Subclass to the Life Domain. Changing Shadowheart's Subclass . Best Barbarian Build. So I decided to go with a light cleric subclass with a dip into fighter for medium armor / shield. geala. You can hate on my comment all you want, but it's the truth. Shadowheart can focus on just healing and supporting teammates in the game with her stats. For Evo, it was fun having everyone stand in Shadowheart's spirit guardians so enemies would come in to kill themselves on it, and then Gale would drop a I’ve played Shadowheart as my resident Vengeance Paladin in two playthroughs (Oathbreaker atm in my 2nd). Let’s discuss our character-building choices and strategies: For Subclass, the Tempest Domain will grant us Heavy Armor proficiency so that we can be closer to melee combat to fire off our Spirit Guardians and other close-range spells. It gets thunder and lightning spells that are always prepared and it gets really strong with thunder acuity hat and reverberation items. You want to spec Shadowheart specifically into healing just because she's easily your most powerful option, but you will need to wait until Withers has joined your camp in order to respec the character from The best subclass for Shadowheart in Baldur’s Gate 3 is the Life Domain. Shar's goal is not merely to make SH choose darkness over light -- it's to do so without giving SH anything at all, no power, no glory, no comfort. Leaning towards Tempest since it gives Heavy Armor without having to take a feat. New. Although there is no best subclass, Larian does have set subclass choices for you when each companion reaches the appropriate level: Gale=Evocation, Lazel=Battlemaster, Karlach=Wildheart, Astarion=Arcane Trickster, Wyll=Blade Pact. Since this is the case, you will want to build her to be a healer. The two other characters I run in the group are Gale, Lae'zel, and sometimes Karlach who I swap out Lae'zel with. With the exception of shadowheart^ Reply reply More replies More replies. You literally cannot do a Sharran run as a paladin. This will turn Shadowheart into a healing powerhouse (Disciple of Life: When casting a healing spell, the target regains additional hit points equal to 2 + the spell’s level), while also giving her access to Heavy Armor for extra protection. Just what classes and subclasses do you think best represent the companion characters? These are just my off-the-top thoughts. At Level 2, Rogues get access to Cunning Actions, and at Which Race is Best For You? Tips & Ideas For Naming Your Character. Once combat is over, use Short Rests, or food and potions if you Circle of the Land is very good indeed but it might feel a bit "vanilla" so if you are undecided but like the theming of the subclass of Spores then I'd say go for that instead first and change later. As such, for this build, you need to Respec her at the camp. It offers an immersive open world, all for the player to explore, overhauled skill systems and gameplay mechanics, and a dark, psychological storyline with believable characters. Races. They also get misty step which is a great mobility option. Once I learned about the Tempest Cleric ability to get max Lightning damage on some rolls, I knew I wanted to build Shadowheart around it. One of Baldur’s Gate 3 favorite characters is Shadowheart, and we can see why. Recently unlocked Gunslinger and was thinking maybe that would pair well with it. Pre level 5 fights were hard and I had a lot of problems. I wouldnt all it best. Best BG3 Gale Build Baldur's Gate 3 Evocation Wizard Build for Gale - best skills, abilities, gear & spells. The best subclass for Shadowheart build is Life Clerics because it provides the best overall healing and group utility for a support class. You get full wizard spell progression. You could probably make an interesting build with Trickery Cleric and Shadow monk. After lvl 5 everything was so easy and I usually didn't use many healing After 5 it doesn't really matter what subclass you do since the main things are just cleric stuff then some subclass flavor (light for fire blasting and tempest for stormy stuff) Or just stay trickery and bump her dex and give her a crossbow Currently doing girl’s night with me (Sorc), Karlach, Lae’zel and Shadowheart, she’s mostly for heals and for summoning the spiritual weapon/spirit guardians/guardian of faith, she also gets some good sacred flames here and there Dunno if you ever got an answer to this, but that "Paladin of X" tag unlocks a couple dialogue options scattered across Act 1. Sabetha1183 • Trickery Cleric fits her, but man is it just not a very good subclass for Cleric in general. All Throne and Liberty Builds; Greatsword Builds; Recommended Subclass. If you wanna respec but keep her relatively normal then going war or light cleric is good, making her ability scores better is good, and adding a couple paladin levels is good. Shadow Monk Shadowheart was a load of fun, big recommend. Which subclass for sorcerer and why . It also comes with a brand-new Homebrew ability, The Best Subclass for Shadowheart build is Life Clerics because it provides the best overall healing and group utility for a support class. Combined The Best Subclass for Shadowheart build is Life Clerics because it provides the best overall healing and group utility for a support Vintage is The New Old Search for: With such a large Wisdom ability score, Shadowheart makes for the perfect Druid that players can experiment with, no matter what subclass they choose, either. Light Domain will make her a lot more useful in your BG3 playthrough. These three items are the core healing pack for Act 1, Act 2, and perhaps some of Act 3. I went moon druid / beast ranger Shadowheart in a Change her Subclass from Trickery to Life domain. This is the subreddit for the Elden Ring gaming community. While Trickery Cleric isn't the best front line subclass, Larian will let you change companions class/subclass and The main ability that Rogues have is Sneak Attack, which grants bonus damage if you are wielding a Finesse weapon (a Rapier or a Short Sword, to name a few) and have an Advantage against the target, or if it is already in combat with a friendly character. mirror images is ok but it isnt good enough for the type of character who leans towards support. We also don't know entirely how the subclass will be in bg3 compared to 5e but the core of how they work will likely be the same. One player mentioned, “She’s an awful cleric subclass to get people to learn the respeccing process at the Good class, decent subclass, and it was still thematically fitting with her worshipping Shar. automatic trickery domain Reply reply Best Subclass For Shadowheart. The best choice is the one that capitalizes on that. Mass healing word restores around 15 hp to everyone at base casting level + 3 temp hp) I did bring Astarion, but I multiclassed him to fighter at level 2. However, the War Domain subclass doesn’t make the best use of higher-level spells and if you’re playing a martial melee build, that can cast spells, and summon creatures, adding more melee focus from here on out is the play. Dont waste time worrying about whats "best" in this game. Baldur’s Gate 3 Best Cleric Build – Leveling Order Level 2 – Cleric. Cleric Subclass A Cleric subclass is a specialization that grants you features at certain Cleric levels, as specified in the which subclass would u reckon goes well for Shadowheart? I mean im a bard, Wyll is a warlock and etc. Healing spells will not out-scale incoming damage, instead use them to either prevent a knock-out in bad terrain, or use Healing Word on a downed team-mate, and continue pressuring the opposition. I’m thinking War Domain, and try to include some support spells in my Bard to supplement. Yet, while Shadowheart is a worshipper of Shar so a Light or Life subclass does not line up but sure both options would work perfectly fine in a Cleric / Wiz multiclass, each with their own strengths. Shadow monk is really good because Shadowheart is basically guaranteed to stay in the smoke most of the time, meaning shadow step has value. If your party doesn't have dedicated DPT, Open Hand will benefit you a lot more. Active discussions help refine subclass options: Gamers are sharing their insights on optimal subclasses, offering valuable perspectives to consider when building Sorcerer 1 / cleric 11 is good. Decent AC with medium armor and shield. I took draconic sorcerer (white) for Armor of Agathys, doesn't require concentration, VERY good when upcast with a higher spell slot. I wanted to see what everyone's thoughts were around the "canonical" subclass would be for each companion (if it is even in The only companions with default subclasses are Shadowheart, Minthara, and Wyll, since their classes require you to pick your subclass at level 1. The overall best build for Shadowheart is the full focus on the cleric class, specifically the “Life Domain” subclass. Rogue Subclasses. Rogue Subclasses Building a Lorehold Character Any class or subclass that deals with knowledge of the past can be a good fit in. Sort by: Best. Ranger 5 lets you double-shoot per turn and being a gloomstalker subclass (at level 3) will give you a bonus shot on turn 1. It depends what you want and value from your cleric. It's amazing to me how they get shafted all the time :( because pass without a trace fits alot better on a ranger. Reply reply Top 1% Rank by size . Shadowheart, Gale, and Lae’zel make the best companions for Good subclass to pair with invader? Remnant 2 Love the invader subclass and wanting to know what it pairs well with? The higher level subclasses I have are handled and alchemist. Any of the 3 will work for Ilmater, though thematically Life is the best suiting to Ilmater. All Throne and Liberty Builds; Greatsword Builds; Dagger Builds; Sword & Shield Builds; Longbow Builds; Crossbow Builds; The slate also reveals that the artefact that Shadowheart has is of great importance to the Queen. Warlock - worth it at 2 levels for agonizing blast and 2 spell slots that refresh on short rest. on protecting their clans from the encroachment of civilized forces such as the Boros. Respeccing into another subclass specifically for Shadowheart works in the story. Best BG3 Shadowheart Build; Best BG3 Astarion Build Guide; Best BG3 Gale Build Guide; Best BG3 Lae’zel Build Guide; Best BG3 Wyll Build Guide; BG3 Classes and Subclass List; BG3 Tier Lists & Top Series; Throne and Liberty. They have a good aoe heal as their oath ability, and their aura halves damage from spells. The Best Subclass for Astarion build is Thief, because it provides additional bonus actions, can pick locks, disarm traps, and has high movement. Recommended Subclass. Reply reply JaimelesBN2 • I reclassed her as a bard college of sword, don’t know if it’s any good. By default, Shadowheart belongs to the Trickery Domain subclass of her Cleric class, which unfortunately is just about the worst option for the party's sole dedicated Cleric 1 / Wizard 11: Honestly any wizard subclass that strikes your fancy. Shadowheart: Trickery 6 / GOO Bladelock 6 --weird, I Trying to change Shadowheart's subclass, "choices pending" BUGS Top 1% Rank by size . And I *definitely* don't mean most effective. This offers a lore-friendly setup that reflects her growth and Whilst the best companions in Baldur's Gate 3 have strength in their original classes, these alternatives provide the best outcome. Players’ Insights on Shadowheart. To support that, Best Cleric sublass for Shadowheart (2nd playthrough) Character Build So during my 1st playthrough I had a team: Oath Paladin (MC), Life Domain Shadowheart, Wildheart barbarian Karlach and Evocation Mage Gale. Intelligence hat recommended for high success with Shadowheart’s spells. Trickery Domain is a pretty bas subclass. Thief is the name of the subclass, not his backstory. Shadowheart was respecced to life cleric (SOOO good with the heal-buffing items that are available. 2 levels of Wizard will get your Wizard subclass. 6 Light Cleric / 6 Swords Bard has full spell progression level. But I like modding in the Bladesinger subclass. Spirit guardians is an incredible damage spell. medium armor and shield for 19+ AC combined with unlimited uses of warding flare for great survivability. Probably needs help from teammates getting enemies Wet for the Lightning damage Vulnerability even though it isn't super needed to strictly beat the game Out of the 3 non-RP options Light Domain is probably my personal favorite. The Cleric class in Baldur’s Gate 3 is a powerful spellcaster and versatile class that can Trickery doesn't have any damage spells, sure, but they have other really good spells. The game will default to a subclass choice but not offer anything for feats. Her dogmatic (brainwashed) worldview fits an Oath of Devotion. You cannot kill her parents, you will oathbreak. A Domain is not the same as a god's portfolio A domain is a category that a god can be placed into which gives clerics certain powers A portfolio is the concepts that a god rules over SUN MONK (Cleric 2 / Monk 6): this has been really versatile but the lack of stats balance is terrible, if i want to maximize the Monk side, i HAVE to take STR, but that'd leave WIS and DEX hanging, without taking in consideration that i HAVE to have at least 14 in CON, so it makes it quite hard to make it a proper build, having the Gloves of Shadowheart: If you want to be super, super accurate to lore, she should reclass into a Life Cleric. Shadowheart doesn't have a choice I don't think. At 6th level it lets you use your channel divinity to turn invisible, which could be interesting to mix with a rogue or a gloomstalker ranger, which both line up with her ability scores, but you’d have to weigh this up with the opportunity cost of the damn good cleric spells you get at every spell level. I know it’s my game and all, but I’m curious to hear what people might think is the best romance for an Origin Shadowheart run I’m doing. Furthermore, the always-prepared spells for the Devotion subclass are odd, giving you healing and weak utility spells. And also has acceptable AOE damage. The Sculpt Spells subclass features create pockets of safety within your Evocation Spell. especially if playing Shadowheart as a Light Cleric. Another great thing about this build is that Our BG3 Shadowheart Build works for PC and Console (PS5 and Xbox Series X/S). Spells: Command, Shield of Faith, Healing Word, Protection From Good and Evil/Speak With Animals, Guiding Bolt Level 3 Hello! I'm currently looking to respec Shadowheart, but I'm unsure what Cleric Subclass I should choose, and what ability scores I should give her. The Berserker subclass comes with Frenzy Strike, Enraged Throw, and Rage turns into Frenzy. But I guess War might also work. While her new stat spread does take away one point from WIS, Yes, Shadowheart seems pretty tanky - her armor class is not far behind that of my sword and shield paladin. As the most arcane-focused Cleric subclass, it I just started my second playthrough (playing as a Lore Bard) and I’m considering changing Shadowheart’s subclass. The Trickery Domain focuses on deceit, illusion, and subterfuge. Also Shadowheart being a Trickery Domain Cleric is very in-line with what we know about Shar and her training in the Cloister. Stack those with just a cantrip and you’re putting out 6d8 damage a turn at level 5 that’s a mix of two of the best damage types in the game. When you play as Shadowheart using her Origin, you gain access to all her powers and spells. You will get different answers from everybody. Looted from Viconia DeVir during Shadowheart’s companion quest in Act 3 (Alternative Shield of Top Three Best Shadowheart Builds in Baldur’s Gate 3. Another makes the right choice when presented with a stranger. Trickery has its uses, I got some crowd control out of her, but 70% of the time her subclass just sucked. Players suggest Nature cleric subclass for Shadowheart. I just really enjoy having her as a Paladin :) Oath of the Ancients & Life Cleric feels amazing to play, and you can do 9/3, 7/5, or 6/6 Pal/Cleric respectively. Takedown request View complete answer on deltiasgaming. Companions Like what is better wild magic or wild heart Share Add a Comment. There is no best subclass, only what works for you. 5. What is the best subclass for Shadowheart Baldur’s Gate 3? Oath of Vengeance is the best subclass for the Paladin because of its bonus action utility, mobility, multiclass potential, and fun factor, ranking it S Tier. A community all about Baldur's Gate III, the role-playing video game by Larian Studios. I’m not very good at multi classing though and wanted to check to see what others thought. The Life Subclass has Heavy Armour Proficiency, Disciple of Life, and Domain Spells. As this is Shadowheart setup, the race is picked by default: Race Features Description; High Half-Elf: Thank you for reading the best Shadowheart Trickery Build for Baldur's Gate 3. Travel to the Mountain Pass. Best Subclass for Lae'zel Battle Master for a Balanced Fighter Gameplay. All Throne and Liberty Best Shadowheart Build Best Subclass. Let's examine the best Shadowheart build in BG3: Check out our Gale BG3 build here About Shadowheart as a Companion. I know it's been said many times that you can still beat Tactician with any class/subclass but seeing as it's my first go at it, I'd like to have a good comp for it while I learn the ropes at a new difficulty. I find the combat spells lacking, and her divine strike being poison isn’t helpful in Act 2 since most enemies are immune to it. old hand. Do whatever makes ya happy though, the game doesn't require precise builds at all. In my non-honour runs I keep him on evocation just because it's easier to not think about the placement as much, and I rarely struggle in combat. See more Heavy armor and healing spells seems to be the best I’ve found. Instead I think I might be tempted to go into draconic bloodline, pickup CC is average at best: fear is decent but (very) hard to land + require to be on the frontline and she's clearly not build for that The thing is, I want to use Shadowheart without changing her class / subclass, at least for a first playthrough and I'm having a hard time making it work. The subclass channel spells are perfectly thematic for a Shar follower. Second, it certainly isn't "balanced". Healing spells are super weak, and with Light Domain especially, you are better off not using them at all outside of an occasional Healing Word - killing enemies earlier is more efficient in D&D. Everything About the Multiclass Cleric in Baldur’s Gate 3. Druid is a full caster meaning you continue your spell progression and you gain access to the Druid spell list, schimatars and wildshape. This is what I would consider the single greatest group healing and support caster build possible for BG3 and the best build for Shadowheart. Ranger. New comments cannot be posted and votes cannot be cast. Combat healing is rarely needed in D&D except to get a knocked out ally up, which any divine caster can do with healing word. You will want enemies to attack you so that you can return lighting and thunder damage. If it's about Selune, sure, but OP doesn't know late act 2 yet, and you cannot build a Sharran Shadowheart Paladin of Devotion without fucking up your oath in the proccess. Not only is it extremely good, but charismatic swashbuckler know it all fits his personality perfectly. When it comes to choosing the best subclass for Shadowheart, there are several options to consider. Does Shadowheart change? Shadowheart: I wanted to prove I was a real Man so I kept her Trickery until the pivotal moment in her story. If you do choose to change her class, then you’ll need to Respec her with Withers, which will cost you 100 Gold. However, you would want to swap out your High Half-Elf race for Wood Elf to increase your Movement Speed by 1. Character Build Hello I'm new to this kind of game and i'm not really sure how to build my paladin First, subclass : My friends are playing a mage and a monk, what do you think is the best subclass for this group ? Made Shadowheart in Dragon's Dogma 2 2. " And it's all 3 of the subclasses. . For those that aren't Shadowheart, 1 level dip of into Cleric for the god of your choice plus Paladin, or vice versa, gets you "Paladin of X" for the other gods. Afaik, Selune doesn't have Light as a domain which makes sense because it's more sunlight and flame than it is moonlight. Elden Ring is an action RPG which takes place in the Lands Between, sometime after the Shattering of the titular Elden Ring. As usual, I never respec my Companions out of their starting class/subclass, but tinker with their stats. I had considered making her a healer, but honestly, at least so far I haven't felt like I needed a dedicated healer - so maybe another damage/support is a good option. This allows you to focus on a specific elemental magic type and also have higher survivability. In case enemies do attack us, the Wrath of the Storm ability Look at the other comments on here. I definitely want to keep her as a Cleric for her main class. I usually go higher damage spells with him like Fireball or ice storm Shadowheart - Cleric (haven't respec'd). what are the best classes (without going too indepth in spoilers) to play while following a romance? be it cause of story, role-play experience, maybe just for party management. Karlach can go Berserk or Wild Magic for funzies, but her Tiger Wild heart always calls her back. Best BG3 Shadowheart Build: Subclass. For Shadowheart, the obvious path is Trickery up to the end of Act 2, then respec into Light, but you can find texts in Act 3 that say that she was one of the best healers amongst her Sharran cloister so Life throughout the entire game would also The whole setup is aimed around her and makes use of her default Trickery Domain subclass. The capstone Shadow Strike ability at level 11 is pretty awesome and I liked having the extra Ki points (vs a multiclass) for more stunning strikes or shadow arts actions. Reply reply What is the best subclass for karlach . ' Astarion would be a good gloomstalker ranger, or warlock of the undying to underscore his tie to his master, if you’re willing to tweak some thematics One subclass adds 1d8 dmg every turn while the other brings in a pet which later Top 1% Rank by size . Any help is appreciated! Edit: Apologies for bad Mobile formatting. One of these makes her a lot more likeable than the other. vkqerwbrggpbhmvdaairdtnkfeymdcqtfhkhpenngvfyeidxdfgueizfudqpbzybbmhfhdkviuskotsodrebf